HPA018007

ITSN1 antibody from Sigma-Aldrich
ITSN, MGC134948, MGC134949, SH3D1A, SH3P17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018007
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018007, RRID:AB_1851836
Product name
Anti-ITSN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018007
Antibody type
Polyclonal
Antigen
Intersectin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIR
KSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIA
MYTYESSEQGDLTFQQGDVILVTKKDGDWW
Storage
-20C
Provider Type Product Number
- No reagents -