HPA017885

GPR179 antibody from Sigma-Aldrich
CSNB1E, GPR158L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017885
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017885, RRID:AB_2279357
Product name
Anti-GPR179 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017885
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 179 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNMLLQANDIRESSVEEDVEWYQALVRSVAEGDPR
VYRALLTFNPPPGASHLQLALQATRTGEETILQDL
SGNWVQEENPPGDLDTPALKKRVLTNDLGSLGSPK
WPQADGYVGDTQQVRLSPPFLECQEGRLRPGWLIT
LSATF
Storage
-20C
Provider Type Product Number
- No reagents -