HPA022923

WIZ antibody from Sigma-Aldrich
ZNF803
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022923, RRID:AB_1858845
Product name
Anti-WIZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022923
Antibody type
Polyclonal
Antigen
Protein Wiz recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPSDLHISPLAKKLPPPPGSPLGHSPTASPPPTAR
KMFPGLAAPSLPKKLKPEQIRVEIKREMLPGALHG
ELHPSEGPWGAPREDMTPLNLSSR
Storage
-20C
Provider Type Product Number
- No reagents -