Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00059350-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00059350-M01, RRID:AB_489999
- Product name
- LGR7 monoclonal antibody (M01), clone 3E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LGR7.
- Antigen sequence
WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPV
QCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNL
IRKLPPDCFKNYHDLQKLYLQNNKI- Isotype
- IgG
- Antibody clone number
- 3E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Localization of relaxin receptors in arteries and veins, and region-specific increases in compliance and bradykinin-mediated relaxation after in vivo serelaxin treatment.
Effect of relaxin on human sperm functions.
Relaxin regulates hyaluronan synthesis and aquaporins in the cervix of late pregnant mice.
Primate preimplantation embryo is a target for relaxin during early pregnancy.
Decreased expression of the rat myometrial relaxin receptor (RXFP1) in late pregnancy is partially mediated by the presence of the conceptus.
Relaxin stimulates osteoclast differentiation and activation.
Suppression of relaxin receptor RXFP1 decreases prostate cancer growth and metastasis.
Characterization of relaxin receptor (RXFP1) desensitization and internalization in primary human decidual cells and RXFP1-transfected HEK293 cells.
Jelinic M, Leo CH, Post Uiterweer ED, Sandow SL, Gooi JH, Wlodek ME, Conrad KP, Parkington H, Tare M, Parry LJ
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Jan;28(1):275-87
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Jan;28(1):275-87
Effect of relaxin on human sperm functions.
Ferlin A, Menegazzo M, Gianesello L, Selice R, Foresta C
Journal of andrology 2012 May-Jun;33(3):474-82
Journal of andrology 2012 May-Jun;33(3):474-82
Relaxin regulates hyaluronan synthesis and aquaporins in the cervix of late pregnant mice.
Soh YM, Tiwari A, Mahendroo M, Conrad KP, Parry LJ
Endocrinology 2012 Dec;153(12):6054-64
Endocrinology 2012 Dec;153(12):6054-64
Primate preimplantation embryo is a target for relaxin during early pregnancy.
Vandevoort CA, Mtango NR, Latham KE, Stewart DR
Fertility and sterility 2011 Jul;96(1):203-7
Fertility and sterility 2011 Jul;96(1):203-7
Decreased expression of the rat myometrial relaxin receptor (RXFP1) in late pregnancy is partially mediated by the presence of the conceptus.
Vodstrcil LA, Shynlova O, Verlander JW, Wlodek ME, Parry LJ
Biology of reproduction 2010 Nov;83(5):818-24
Biology of reproduction 2010 Nov;83(5):818-24
Relaxin stimulates osteoclast differentiation and activation.
Ferlin A, Pepe A, Facciolli A, Gianesello L, Foresta C
Bone 2010 Feb;46(2):504-13
Bone 2010 Feb;46(2):504-13
Suppression of relaxin receptor RXFP1 decreases prostate cancer growth and metastasis.
Feng S, Agoulnik IU, Truong A, Li Z, Creighton CJ, Kaftanovskaya EM, Pereira R, Han HD, Lopez-Berestein G, Klonisch T, Ittmann MM, Sood AK, Agoulnik AI
Endocrine-related cancer 2010 Dec;17(4):1021-33
Endocrine-related cancer 2010 Dec;17(4):1021-33
Characterization of relaxin receptor (RXFP1) desensitization and internalization in primary human decidual cells and RXFP1-transfected HEK293 cells.
Kern A, Bryant-Greenwood GD
Endocrinology 2009 May;150(5):2419-28
Endocrinology 2009 May;150(5):2419-28
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LGR7 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol