Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005533 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005533, RRID:AB_1079352
- Product name
- Anti-MEF2C
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPL
AHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSG
AGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPP
PMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mef2c regulates transcription of the extracellular matrix protein cartilage link protein 1 in the developing murine heart.
Evolutionary conservation of Nkx2.5 autoregulation in the second heart field.
Differential expression of cartilage and bone-related proteins in pediatric and adult diseased aortic valves.
MicroRNA-21 dysregulates the expression of MEF2C in neurons in monkey and human SIV/HIV neurological disease.
Lockhart MM, Wirrig EE, Phelps AL, Ghatnekar AV, Barth JL, Norris RA, Wessels A
PloS one 2013;8(2):e57073
PloS one 2013;8(2):e57073
Evolutionary conservation of Nkx2.5 autoregulation in the second heart field.
Clark CD, Zhang B, Lee B, Evans SI, Lassar AB, Lee KH
Developmental biology 2013 Feb 1;374(1):198-209
Developmental biology 2013 Feb 1;374(1):198-209
Differential expression of cartilage and bone-related proteins in pediatric and adult diseased aortic valves.
Wirrig EE, Hinton RB, Yutzey KE
Journal of molecular and cellular cardiology 2011 Mar;50(3):561-9
Journal of molecular and cellular cardiology 2011 Mar;50(3):561-9
MicroRNA-21 dysregulates the expression of MEF2C in neurons in monkey and human SIV/HIV neurological disease.
Yelamanchili SV, Chaudhuri AD, Chen LN, Xiong H, Fox HS
Cell death & disease 2010;1(9):e77
Cell death & disease 2010;1(9):e77
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and MEF2C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419349).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & vesicles.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA005533 antibody. Corresponding MEF2C RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate nuclear positivity in germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
- Sample type
- HUMAN