HPA005533

MEF2C antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005533
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005533, RRID:AB_1079352
Product name
Anti-MEF2C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005533
Antibody type
Polyclonal
Antigen
Myocyte-specific enhancer factor 2C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPL
AHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSG
AGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPP
PMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
Storage
-20C
Provider Type Product Number
- No reagents -