HPA003215

OGFOD1 antibody from Atlas Antibodies
FLJ10826, KIAA1612, TPA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003215
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003215, RRID:AB_887581
Product name
Anti-OGFOD1
Provider product page
Atlas Antibodies - HPA003215
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPENNQMAISNNSQQSNEQTDPEPEENETKKESSV
PMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCG
CEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLAL
VYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFS
F
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -