HPA003215

OGFOD1 antibody from Sigma-Aldrich
FLJ10826, KIAA1612, TPA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003215
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003215, RRID:AB_1078881
Product name
Anti-OGFOD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003215
Antibody type
Polyclonal
Antigen
2-Oxoglutarate and iron-dependent oxygenase domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPENNQMAISNNSQQSNEQTDPEPEENETKKESSV
PMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCG
CEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLAL
VYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFS
F
Storage
-20C
Provider Type Product Number
- No reagents -