Antibody data

Product number
H00005711-M17
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005711-M17, RRID:AB_1579277
Product name
PSMD5 monoclonal antibody (M17), clone 1H7
Provider product page
Abnova Corporation - H00005711-M17
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PSMD5.
Antigen sequence
MAAQALALLREVARLEAPLEELRALHSVLQAVPLN
ELRQQAAELRLGPLFSLLNENHREKTTLCVSILER
LLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLS
QIGRIVENSDAVTEILNNAELLKQIVYCIGGENLS
VAKAAIKSLSRISLTQAGLEALFESNLLDDLKSVM
KTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVT
QLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLA
QEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNL
AVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVA
VDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQS
KNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTE
SWFSSLSRDPLELFRGISSQPFPELHCAALKVFTA
IANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDA
KYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPY
YVKPVSTTAVEGAE
Isotype
IgG
Antibody clone number
1H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -