HPA003216

PSMD5 antibody from Sigma-Aldrich
KIAA0072, S5B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003216
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003216, RRID:AB_1079709
Product name
Anti-PSMD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003216
Antibody type
Polyclonal
Antigen
26S proteasome non-ATPase regulatory subunit 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAQALALLREVARLEAPLEELRALHSVLQAVPLNE
LRQQAAELRLGPLFSLLNENHREKTTLCVSILERL
LQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQ
IGRIVENSDAVTEILNNAELLKQIVYCIGGENLS
Storage
-20C
Provider Type Product Number
- No reagents -