Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003218 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003218, RRID:AB_1078695
- Product name
- Anti-DOCK8
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AIANSLHNSKDLSKDQHGRNCLLASYVHYVFRLPE
VQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKL
LQARVMSSSNPDLAGTHSAADEEVKNIMSSKIADR
NCSRMSYYCSGSSDAPSS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A DOCK8-WIP-WASp complex links T cell receptors to the actin cytoskeleton
TGF-β1-Induced Epithelial–Mesenchymal Transition Promotes Monocyte/Macrophage Properties in Breast Cancer Cells
DOCK8 functions as an adaptor that links TLR-MyD88 signaling to B cell activation
Janssen E, Tohme M, Hedayat M, Leick M, Kumari S, Ramesh N, Massaad M, Ullas S, Azcutia V, Goodnow C, Randall K, Qiao Q, Wu H, Al-Herz W, Cox D, Hartwig J, Irvine D, Luscinskas F, Geha R
Journal of Clinical Investigation 2016;126(10):3837-3851
Journal of Clinical Investigation 2016;126(10):3837-3851
TGF-β1-Induced Epithelial–Mesenchymal Transition Promotes Monocyte/Macrophage Properties in Breast Cancer Cells
Johansson J, Tabor V, Wikell A, Jalkanen S, Fuxe J
Frontiers in Oncology 2015;5
Frontiers in Oncology 2015;5
DOCK8 functions as an adaptor that links TLR-MyD88 signaling to B cell activation
Jabara H, McDonald D, Janssen E, Massaad M, Ramesh N, Borzutzky A, Rauter I, Benson H, Schneider L, Baxi S, Recher M, Notarangelo L, Wakim R, Dbaibo G, Dasouki M, Al-Herz W, Barlan I, Baris S, Kutukculer N, Ochs H, Plebani A, Kanariou M, Lefranc G, Reisli I, Fitzgerald K, Golenbock D, Manis J, Keles S, Ceja R, Chatila T, Geha R
Nature Immunology 2012;13(6):612-620
Nature Immunology 2012;13(6):612-620
No comments: Submit comment
No validations: Submit validation data