HPA003218

DOCK8 antibody from Sigma-Aldrich
FLJ00026, FLJ00152, FLJ00346, ZIR8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003218
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003218, RRID:AB_1078695
Product name
Anti-DOCK8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003218
Antibody type
Polyclonal
Antigen
Dedicator of cytokinesis protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIANSLHNSKDLSKDQHGRNCLLASYVHYVFRLPE
VQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKL
LQARVMSSSNPDLAGTHSAADEEVKNIMSSKIADR
NCSRMSYYCSGSSDAPSS
Storage
-20C
Provider Type Product Number
- No reagents -