HPA026517

PEAK1 antibody from Sigma-Aldrich
KIAA2002, sgk269
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026517
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026517, RRID:AB_1856802
Product name
Anti-AC107883.6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026517
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase SgK269 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLA
LRLEEKDGKIAVQTEKEESKASTDVAGQAVTINLV
PTEEQAKPYRVVNLEQPLCK
Storage
-20C
Provider Type Product Number
- No reagents -