Antibody data

Product number
ABIN406664
Provider
antibodies-online
Product name
anti-General Transcription Factor IIA, 1, 19/37kDa (GTF2A1) antibody
Provider product page
antibodies-online - ABIN406664
Antibody type
Polyclonal
Antigen
The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the N terminal of human GTF2A1
Reactivity
Human, Mouse, Rat, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDE
QVLME LKTLWENKLM
Vial size
50 µg
Provider Type Product Number
- No reagents -