HPA000869

GTF2A1 antibody from Atlas Antibodies
TFIIA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000869
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000869, RRID:AB_1080253
Product name
Anti-GTF2A1
Provider product page
Atlas Antibodies - HPA000869
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNAS
NMSAAATAATLALPAGVTPVQQILTNSGQLLQVVR
AANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVI
QQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIP
TTVAAPTPAQA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -