HPA000869

GTF2A1 antibody from Sigma-Aldrich
TFIIA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000869
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000869, RRID:AB_1080253
Product name
Anti-GTF2A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000869
Antibody type
Polyclonal
Antigen
Transcription initiation factor IIA subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNAS
NMSAAATAATLALPAGVTPVQQILTNSGQLLQVVR
AANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVI
QQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIP
TTVAAPTPAQA
Storage
-20C
Provider Type Product Number
- No reagents -