HPA003195

CILP antibody from Sigma-Aldrich
HsT18872
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003195
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003195, RRID:AB_1078524
Product name
Anti-CILP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003195
Antibody type
Polyclonal
Antigen
Cartilage intermediate layer protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKV
AQLIVTASDETPCNPVPESYLIRLPHDCFQNATNS
FYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISK
TEEREIQCSGYTLPTK
Storage
-20C
Provider Type Product Number
- No reagents -