HPA026562

OPLAH antibody from Atlas Antibodies
5-Opase, OPLA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026562
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026562, RRID:AB_1854804
Product name
Anti-OPLAH
Provider product page
Atlas Antibodies - HPA026562
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTP
AIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMD
TFSGSSAVLSGPAGGVVGYSATTY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -