HPA026562

OPLAH antibody from Sigma-Aldrich
5-Opase, OPLA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026562
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026562, RRID:AB_1854804
Product name
Anti-OPLAH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026562
Antibody type
Polyclonal
Antigen
5-oxoprolinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTP
AIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMD
TFSGSSAVLSGPAGGVVGYSATTY
Storage
-20C
Provider Type Product Number
- No reagents -