HPA003198

CCT2 antibody from Sigma-Aldrich
Cctb
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003198
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003198, RRID:AB_1078424
Product name
Anti-CCT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003198
Antibody type
Polyclonal
Antigen
T-complex protein 1 subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDS
TAKVAEIEHAEKEKMKEKVERILKHGINCFINRQL
IYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGE
IASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGV
Storage
-20C
Provider Type Product Number
- No reagents -