AMAb91166

antibody from Atlas Antibodies

Targeting: LAMA2 LAMM

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

AMAb91166

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91166, RRID:AB_2665829

Product name

Anti-LAMA2

Antibody type

Monoclonal

Reactivity

Human, Mouse, Rat

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

DKLKPIKELEDNLKKNISEIKELINQARKQANSIK
VSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVAD
NLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVG
RVEYPDLTIDDSYWYRIVASRTGRNGT


Epitope

Binds to an epitope located within the peptide sequence DKLKPIKELEDNLKK as determined by overlapping synthetic peptides.

Isotype

IgG

Antibody clone number

CL3450

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis of purified human recombinant Laminin-211, Laminin-221, Laminin-332, Laminin-421, Laminin-511 and Laminin-121.

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human heart muscle and tonsil tissues using AMAb91166 antibody. Corresponding LAMA2 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human heart muscle shows membranous immunoreactivity in muscle fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows positivity in basement membrane of glandular epithelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human placenta shows immunoreactivity in basement membrane of trophoblast.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows positivity in endothelium of blood vessels.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows absence of immunoreactivity in lymphoid tissue (negative control).

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat heart muscle shows strong membranous immunoreactivity in cardiomyocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat skeletal muscle shows strong membranous positivity in muscle fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat pancreas shows immunoreactivity in basement membrane surrounding exocrine glands.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat cerebral cortex shows positivity in blood vessel walls.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse heart muscle shows strong membranous positivity in cardiomyocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse pancreas shows immunoreactivity in basement membrane.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human heart muscle shows strong membranous positivity in cardiomyocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human placenta shows moderate positivity in basement membrane of trophoblastic cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate positivity in blood vessels.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat heart muscle shows strong membranous positivity in cardiomyocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat stomach shows strong positivity in basement membrane of glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse heart muscle shows strong membranous positivity in cardiomyocytes.