Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003908-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003908-M01, RRID:AB_489754
- Product name
- LAMA2 monoclonal antibody (M01), clone 2D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LAMA2.
- Antigen sequence
DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVE
AQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSI
PFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPV
SCPAN- Isotype
- IgG
- Antibody clone number
- 2D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Advanced intimal hyperplasia without luminal narrowing of leptomeningeal arteries in CADASIL.
Quiescent fibroblasts exhibit high metabolic activity.
Dong H, Ding H, Young K, Blaivas M, Christensen PJ, Wang MM
Stroke; a journal of cerebral circulation 2013 May;44(5):1456-8
Stroke; a journal of cerebral circulation 2013 May;44(5):1456-8
Quiescent fibroblasts exhibit high metabolic activity.
Lemons JM, Feng XJ, Bennett BD, Legesse-Miller A, Johnson EL, Raitman I, Pollina EA, Rabitz HA, Rabinowitz JD, Coller HA
PLoS biology 2010 Oct 19;8(10):e1000514
PLoS biology 2010 Oct 19;8(10):e1000514
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LAMA2 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to LAMA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol