HPA005537

LAMA2 antibody from Sigma-Aldrich
LAMM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005537
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005537, RRID:AB_1079223
Product name
Anti-LAMA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005537
Antibody type
Polyclonal
Antigen
Laminin subunit alpha-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKLKPIKELEDNLKKNISEIKELINQARKQANSIK
VSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVAD
NLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVG
RVEYPDLTIDDSYWYRIVASRTGRNGT
Storage
-20C
Provider Type Product Number
- No reagents -