Explore
Validate
Learn
Western blot
ImmunoprecipitationAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA40AG - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- Podoplanin
- Antibody type
- Polyclonal
- Antigen
- Recombinant human Podoplanin
- Description
- antibody affinity purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GSSHHHHHHSSGLVPRGSHMEGASTGQPEDDTETT
GLEGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATS
VNSVTGIRIEDLPTSESTVHAQEQSPSATASNVAT
SHsTEKVDGDTQTTVEKDGLST- Antibody clone number
- Rabbit IG
- Vial size
- 50 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references Engineering Blood and Lymphatic Microvascular Networks in Fibrin Matrices
Isolation and Characterization of Human Lung Lymphatic Endothelial Cells
Altered regulation of Prox1-gene-expression in liver tumors
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Knezevic L, Schaupper M, Mühleder S, Schimek K, Hasenberg T, Marx U, Priglinger E, Redl H, Holnthoner W
Frontiers in Bioengineering and Biotechnology 2017 April;5
Frontiers in Bioengineering and Biotechnology 2017 April;5
Isolation and Characterization of Human Lung Lymphatic Endothelial Cells
Lorusso B, Falco A, Madeddu D, Frati C, Cavalli S, Graiani G, Gervasi A, Rinaldi L, Lagrasta C, Maselli D, Gnetti L, Silini E, Quaini E, Ampollini L, Carbognani P, Quaini F
BioMed Research International 2015 ;2015
BioMed Research International 2015 ;2015
Altered regulation of Prox1-gene-expression in liver tumors
Dudas J, Mansuroglu T, Moriconi F, Haller F, Wilting J, Lorf T, Füzesi L, Ramadori G
BMC Cancer 2008 December;8(1)
BMC Cancer 2008 December;8(1)
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1
Kilic N, Oliveira-Ferrer L, Neshat-Vahid S, Irmak S, Obst-Pernberg K, Wurmbach J, Loges S, Kilic E, Weil J, Lauke H, Tilki D, Singer B, Ergun S
Blood 2007 December;110(13):4223-4233
Blood 2007 December;110(13):4223-4233
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Van der Auwera I
Clinical Cancer Research 2005 November;11(21):7637-7642
Clinical Cancer Research 2005 November;11(21):7637-7642
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis of recombinant human [Cat# S01-046], mouse [Cat# S01-M46] and rat [Cat# S01-R46] soluble Podoplanin using a rabbit polyclonal anti-human Podoplanin antibody [Cat# 102-PA40AG]. There is a weak cross reactivity with mouse and rat Podoplanin visible.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Functional ELISA with anti-human Podoplanin [Cat# 102-PA40AG]. Recombinant human soluble Podoplanin [Cat# S01-046] was coated with increasing amounts in a 96 well microtiter plate.
