Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA40 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- Podoplanin
- Antibody type
- Polyclonal
- Antigen
- Recombinant human Podoplanin
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GSSHHHHHHSSGLVPRGSHMEGASTGQPEDDTETT
GLEGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATS
VNSVTGIRIEDLPTSESTVHAQEQSPSATASNVAT
SHsTEKVDGDTQTTVEKDGLST- Antibody clone number
- Rabbit IG
- Vial size
- 200 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references Engineering Blood and Lymphatic Microvascular Networks in Fibrin Matrices
Isolation and Characterization of Human Lung Lymphatic Endothelial Cells
Molecular and Cellular Effects of In Vitro Shockwave Treatment on Lymphatic Endothelial Cells
Altered regulation of Prox1-gene-expression in liver tumors
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1
Isolation and characterization of lymphatic microvascular endothelial cells from human tonsils
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Isolation, purification, and heterogeneity of human lymphatic endothelial cells from different tissues.
Knezevic L, Schaupper M, Mühleder S, Schimek K, Hasenberg T, Marx U, Priglinger E, Redl H, Holnthoner W
Frontiers in Bioengineering and Biotechnology 2017 April;5
Frontiers in Bioengineering and Biotechnology 2017 April;5
Isolation and Characterization of Human Lung Lymphatic Endothelial Cells
Lorusso B, Falco A, Madeddu D, Frati C, Cavalli S, Graiani G, Gervasi A, Rinaldi L, Lagrasta C, Maselli D, Gnetti L, Silini E, Quaini E, Ampollini L, Carbognani P, Quaini F
BioMed Research International 2015 ;2015
BioMed Research International 2015 ;2015
Molecular and Cellular Effects of In Vitro Shockwave Treatment on Lymphatic Endothelial Cells
Rohringer S, Holnthoner W, Hackl M, Weihs A, Rünzler D, Skalicky S, Karbiener M, Scheideler M, Pröll J, Gabriel C, Schweighofer B, Gröger M, Spittler A, Grillari J, Redl H, Dulak J
PLoS ONE 2014 December;9(12)
PLoS ONE 2014 December;9(12)
Altered regulation of Prox1-gene-expression in liver tumors
Dudas J, Mansuroglu T, Moriconi F, Haller F, Wilting J, Lorf T, Füzesi L, Ramadori G
BMC Cancer 2008 ;8(1):92
BMC Cancer 2008 ;8(1):92
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1
Kilic N, Oliveira-Ferrer L, Neshat-Vahid S, Irmak S, Obst-Pernberg K, Wurmbach J, Loges S, Kilic E, Weil J, Lauke H, Tilki D, Singer B, Ergun S
Blood 2007 December;110(13):4223-4233
Blood 2007 December;110(13):4223-4233
Isolation and characterization of lymphatic microvascular endothelial cells from human tonsils
Garrafa E, Alessandri G, Benetti A, Turetta D, Corradi A, Cantoni A, Cervi E, Bonardelli S, Parati E, Giulini S, Ensoli B, Caruso A
Journal of Cellular Physiology 2006 April;207(1):107-113
Journal of Cellular Physiology 2006 April;207(1):107-113
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Van der Auwera I
Clinical Cancer Research 2005 November;11(21):7637-7642
Clinical Cancer Research 2005 November;11(21):7637-7642
Isolation, purification, and heterogeneity of human lymphatic endothelial cells from different tissues.
Garrafa E, Trainini L, Benetti A, Saba E, Fezzardi L, Lorusso B, Borghetti P, Bottio T, Ceri E, Portolani N, Bonardlli S, Giulini SM, Annibale G, Corradi A, Imberti L, Caruso A
Lymphology 2005 Dec;38(4):159-66
Lymphology 2005 Dec;38(4):159-66
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western blot analysis of Podoplanin expression in human lymphatic endothelial cells (LEC) and HUVECs. Total lysate of both cell types were subjected to SDS-PAGE and subsequent Western analysis with the polyclonal (#102-PA40) antibodies. The antibody recognizes a protein of about 36 kDa in total lysate from LECs but not from HUVEC.
- Sample type
- Cell lysate