HPA007534

PDPN antibody from Atlas Antibodies
aggrus, Gp38, GP40, PA2.26, T1A-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007534
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007534, RRID:AB_1857718
Product name
Anti-PDPN
Provider product page
Atlas Antibodies - HPA007534
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLPRVWEARAPSLSGAPAPTPPAPPPSRSSRLGLW
PRCFLIFPQLRILLLGPQESNNSTGTMWKVSALLF
VLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMP
GAEDDVVTPGTSEDRYKSGLTTLVATSVNS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -