HPA012836

FOXD4L4 antibody from Sigma-Aldrich
bA460E7.2, FOXD4L2, OTTHUMG00000013337, OTTHUMG00000066752
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012836
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012836, RRID:AB_2105429
Product name
Anti-FOXD4L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012836
Antibody type
Polyclonal
Antigen
Forkhead box protein D4-like 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEDEDEVEDEEEEARQQFLEQSLQPGLQVARWGGV
ALPREHIEGGGGPSDPSEFGTKFRAPPRSAAASED
ARQPAKPPYSYIALITMAILQNPHKRLTLSGICAF
ISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPRE
PGHPGKG
Storage
-20C
Provider Type Product Number
- No reagents -