Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000893 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000893, RRID:AB_10794315
- Product name
- Anti-SERPINA3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTA
LAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQS
FQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRF
TEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGG
APHR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Antibody-based profiling of cerebrospinal fluid within multiple sclerosis
Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P, Kim K
PLoS Pathogens 2014 April;10(4)
PLoS Pathogens 2014 April;10(4)
Antibody-based profiling of cerebrospinal fluid within multiple sclerosis
Häggmark A, Byström S, Ayoglu B, Qundos U, Uhlén M, Khademi M, Olsson T, Schwenk J, Nilsson P
PROTEOMICS 2013 August;13(15):2256-2267
PROTEOMICS 2013 August;13(15):2256-2267
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, cervix, uterine, colon and liver using Anti-SERPINA3 antibody HPA000893 (A) shows similar protein distribution across tissues to independent antibody HPA002560 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows extracellular positivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-SERPINA3 antibody HPA000893.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-SERPINA3 antibody HPA000893.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine using Anti-SERPINA3 antibody HPA000893.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-SERPINA3 antibody HPA000893.
- Sample type
- HUMAN