HPA001625

PNP antibody from Sigma-Aldrich
NP, PUNP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001625
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001625, RRID:AB_1854577
Product name
Anti-NP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001625
Antibody type
Polyclonal
Antigen
Purine nucleoside phosphorylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLT
DKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLN
GRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVD
TLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQ
NPLRGPNDERGAPHR
Storage
-20C
Provider Type Product Number
- No reagents -