HPA004916

DIAPH1 antibody from Sigma-Aldrich
DFNA1, hDIA1, LFHL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004916
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004916, RRID:AB_1847668
Product name
Anti-DIAPH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004916
Antibody type
Polyclonal
Antigen
Protein diaphanous homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAF
MNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDA
AKLLSALCILPQPEDMNERVLEAMTERAEMDEVER
FQPLLDGLKSGTTIALKVGCLQLINALITPAE
Storage
-20C
Provider Type Product Number
- No reagents -