HPA001223

antibody from Atlas Antibodies

Targeting: CBS HIP4

Antibody data

Submit

Validation data

Product number: HPA001223 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001223, RRID:AB_1846112
Product name: Anti-CBS
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGN TGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRAL GAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHI LDQYRNASNPLAHYDTTADEILQQCDGKLDMLVAS VGTGGTITGIGAPHR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CBS protein structure - HPA001223 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA001223 antibody. Corresponding CBS RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in a subset of cells in granular layer, as well as in neuropil of molecular layer.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN