Antibody data

Product number
PAB20759
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20759, RRID:AB_10963903
Product name
TMEM192 polyclonal antibody
Provider product page
Abnova Corporation - PAB20759
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMEM192.
Antigen sequence
EPDILEEEKIYAYPSNITSETGFRTISSLEEIVEK
QGDTIEYLKRHNALLSKRLLALTSSDLGCQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -