Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019869 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019869, RRID:AB_1849801
- Product name
- Anti-GSTP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYT
NYEAGKDDYVKALPGQLKPFETLLS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Breast Cancer Proteomics - Differences in Protein Expression between Estrogen Receptor-Positive and -Negative Tumors Identified by Tandem Mass Tag Technology.
Ruckhäberle E, Karn T, Hanker L, Schwarz J, Schulz-Knappe P, Kuhn K, Böhm G, Selzer S, Erhard N, Engels K, Holtrich U, Kaufmann M, Rody A
Breast care (Basel, Switzerland) 2010 Mar;5(1):7-10
Breast care (Basel, Switzerland) 2010 Mar;5(1):7-10
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-GSTP1 antibody HPA019869 (A) shows similar pattern to independent antibody HPA019779 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human kidney, liver, testis and urinary bladder using Anti-GSTP1 antibody HPA019869 (A) shows similar protein distribution across tissues to independent antibody HPA019779 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows cytoplasmic positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-GSTP1 antibody HPA019869.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-GSTP1 antibody HPA019869.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-GSTP1 antibody HPA019869.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder using Anti-GSTP1 antibody HPA019869.
- Sample type
- HUMAN