HPA019869

GSTP1 antibody from Atlas Antibodies
FAEES3, GST3, GSTP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019869
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019869, RRID:AB_1849801
Product name
Anti-GSTP1
Provider product page
Atlas Antibodies - HPA019869
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYT
NYEAGKDDYVKALPGQLKPFETLLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -