Antibody data
- Antibody Data
 - Antigen structure
 - References [2]
 - Comments [0]
 - Validations
 - Western blot [1]
 - Immunocytochemistry [1]
 - Immunoprecipitation [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00002950-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00002950-M01, RRID:AB_425468
 - Product name
 - GSTP1 monoclonal antibody (M01), clone 2G6-F6
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a full length recombinant GSTP1.
 - Antigen sequence
 MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVT
VETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTIL
RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYV
SLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG
KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFP
LLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ- Isotype
 - IgG
 - Antibody clone number
 - 2G6-F6
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		Polymorphism of the glutathione S-transferase P1 gene (GST-pi) in breast carcinoma.
				
Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization.
				
		
	
			Khabaz MN
Polish journal of pathology : official journal of the Polish Society of Pathologists 2014 Jun;65(2):141-6
		Polish journal of pathology : official journal of the Polish Society of Pathologists 2014 Jun;65(2):141-6
Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization.
			Kan CY, Wen VW, Pasquier E, Jankowski K, Chang M, Richards LA, Kavallaris M, MacKenzie KL
Oncogene 2012 Nov 15;31(46):4815-27
		Oncogene 2012 Nov 15;31(46):4815-27
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of GSTP1 expression in transfected 293T cell line by GSTP1 monoclonal antibody (M01), clone 2G6-F6.Lane 1: GSTP1 transfected lysate (Predicted MW: 23.3 KDa).Lane 2: Non-transfected lysate.
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescence of monoclonal antibody to GSTP1 on HeLa cell. [antibody concentration 10 ug/ml]
 - Validation comment
 - Immunofluorescence
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoprecipitation of GSTP1 transfected lysate using anti-GSTP1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GSTP1 MaxPab rabbit polyclonal antibody.
 - Validation comment
 - Immunoprecipitation
 - Protocol
 - Protocol