ABIN502955

GSTP1 antibody from antibodies-online
FAEES3, GST3, GSTP

Antibody data

Product number
ABIN502955
Provider
antibodies-online
Product name
anti-Glutathione S-Transferase pi 1 (GSTP1) antibody
Provider product page
antibodies-online - ABIN502955
Antibody type
Polyclonal
Antigen
The immunogen for anti-GSTP1 antibody: synthetic peptide directed towards the N terminal of human GSTP1
Reactivity
Human
Host
Rabbit
Antigen sequence
TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTI
LRHLG RTLGLYGKDQ
Vial size
50 µg
Provider Type Product Number
- No reagents -