HPA019779

GSTP1 antibody from Sigma-Aldrich
FAEES3, GST3, GSTP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019779
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019779, RRID:AB_1849799
Product name
Anti-GSTP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019779
Antibody type
Polyclonal
Antigen
Glutathione S-transferase P recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFP
LLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Storage
-20C
Provider Type Product Number
- No reagents -