HPA002328

MAOB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002328
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002328, RRID:AB_1854062
Product name
Anti-MAOB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002328
Antibody type
Polyclonal
Antigen
Amine oxidase [flavin-containing] B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WRTMDDMGREIPSDAPWKAPLAEEWDNMTMKELLD
KLCWTESAKQLATLFVNLCVTAETHEVSALWFLWY
VKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMD
LLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAK
YVISAIPPTLGAPHR
Storage
-20C
Provider Type Product Number
- No reagents -