Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PA5-109672 - Provider product page
- Provider
- Invitrogen Antibodies
- Product name
- ECE1 Polyclonal Antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant full-length protein
- Description
- Sequence of this protein is as follows: ADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 100 µL
- Concentration
- 0.62 mg/mL
- Storage
- -20° C, Avoid Freeze/Thaw Cycles
No comments: Submit comment
Supportive validation
- Submitted by
- Invitrogen Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of ECE1 in mouse liver. Samples were incubated in polyclonal ECE1 antibody (Product # PA5-109672) using a dilution of 1:1000, followed by HRP Goat Anti-Rabbit IgG (H+L) at a dilution of 1:10000.
Supportive validation
- Submitted by
- Invitrogen Antibodies (provider)
- Main image
- Experimental details
- Immunocytochemistry analysis of ECE1 in L929 cells. Samples were incubated in polyclonal ECE1 antibody (Product # PA5-109672) using a dilution of 1:100, followed by DAPI.
Supportive validation
- Submitted by
- Invitrogen Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemistry analysis of ECE1 in paraffin-embedded human mammary cancer tissue. Samples were incubated in polyclonal ECE1 antibody (Product # PA5-109672) using a dilution of 1:100.
- Submitted by
- Invitrogen Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemistry analysis of ECE1 in paraffin-embedded mouse kidney tissue. Samples were incubated in polyclonal ECE1 antibody (Product # PA5-109672) using a dilution of 1:100.
- Submitted by
- Invitrogen Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemistry analysis of ECE1 in paraffin-embedded rat spleen tissue. Samples were incubated in polyclonal ECE1 antibody (Product # PA5-109672) using a dilution of 1:100.