HPA013616

ECE1 antibody from MilliporeSigma / Merck KGaA
ECE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013616
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013616, RRID:AB_1847963
Product name
Anti-ECE1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013616
Antibody type
Polyclonal
Antigen
Endothelin-converting enzyme 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEKVLTGYLNYMVQLGKLLGGGDEEAIRPQMQQIL
DFETALANITIPQEKRRDEELIYHKVTAAELQTLA
PAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQI
STLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDA
DEKFMEV
Storage
-20C
Provider Type Product Number
- No reagents -