HPA020632

SCAI antibody from Atlas Antibodies
C9orf126, FLJ36664, NET40
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020632
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020632, RRID:AB_1845804
Product name
Anti-SCAI
Provider product page
Atlas Antibodies - HPA020632
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLYKPTFSQLYTFLAASFKELPANSVLLIYLSATG
VFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKR
NQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAY
KNFT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -