HPA020632

SCAI antibody from Sigma-Aldrich
C9orf126, FLJ36664, NET40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020632
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020632, RRID:AB_1845804
Product name
Anti-C9orf126 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020632
Antibody type
Polyclonal
Antigen
UPF0682 protein C9orf126 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLYKPTFSQLYTFLAASFKELPANSVLLIYLSATG
VFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKR
NQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAY
KNFT
Storage
-20C
Provider Type Product Number
- No reagents -