Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182741 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Matrix Metallopeptidase 9 (Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase) (MMP9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MMP9 antibody: synthetic peptide directed towards the N terminal of human MMP9
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDD
DELWS LGKGVVVPTR- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Pyrrolidine dithiocarbamate attenuates surgery-induced neuroinflammation and cognitive dysfunction possibly via inhibition of nuclear factor κB.
Local arterial stiffening assessed by MRI precedes atherosclerotic plaque formation.
Class II major histocompatibility complex transactivator (CIITA) inhibits matrix metalloproteinase-9 gene expression.
Zhang J, Jiang W, Zuo Z
Neuroscience 2014 Mar 7;261:1-10
Neuroscience 2014 Mar 7;261:1-10
Local arterial stiffening assessed by MRI precedes atherosclerotic plaque formation.
Gotschy A, Bauer E, Schrodt C, Lykowsky G, Ye YX, Rommel E, Jakob PM, Bauer WR, Herold V
Circulation. Cardiovascular imaging 2013 Nov;6(6):916-23
Circulation. Cardiovascular imaging 2013 Nov;6(6):916-23
Class II major histocompatibility complex transactivator (CIITA) inhibits matrix metalloproteinase-9 gene expression.
Nozell S, Ma Z, Wilson C, Shah R, Benveniste EN
The Journal of biological chemistry 2004 Sep 10;279(37):38577-89
The Journal of biological chemistry 2004 Sep 10;279(37):38577-89
No comments: Submit comment
No validations: Submit validation data