HPA001238

MMP9 antibody from Sigma-Aldrich
CLG4B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001238
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001238, RRID:AB_1079398
Product name
Anti-MMP9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001238
Antibody type
Polyclonal
Antigen
Matrix metalloproteinase-9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYT
RVAEMRGESKSLGPALLLLQKQLSLPETGELDSAT
LKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWI
QNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVY
SRDADI
Storage
-20C
Provider Type Product Number
- No reagents -