HPA024376

SENP6 antibody from Atlas Antibodies
KIAA0797, SUSP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024376
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024376, RRID:AB_1856678
Product name
Anti-SENP6
Provider product page
Atlas Antibodies - HPA024376
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGP
LLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPI
DIIVNCDDSKHTYLQTNGKVILPGAKIPKITNLKE
RKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQP
ADSACSSPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -