Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024376 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024376, RRID:AB_1856678
- Product name
- Anti-SENP6
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGP
LLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPI
DIIVNCDDSKHTYLQTNGKVILPGAKIPKITNLKE
RKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQP
ADSACSSPA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Histone demethylase KDM2A is a selective vulnerability of cancers relying on alternative telomere maintenance
Genetic alterations of the SUMO isopeptidase SENP6 drive lymphomagenesis and genetic instability in diffuse large B-cell lymphoma
SENP6 induces microglial polarization and neuroinflammation through de-SUMOylation of Annexin-A1 after cerebral ischaemia–reperfusion injury
Inhibition of SENP6 restrains cerebral ischemia-reperfusion injury by regulating Annexin-A1 nuclear translocation-associated neuronal apoptosis
Li F, Wang Y, Hwang I, Jang J, Xu L, Deng Z, Yu E, Cai Y, Wu C, Han Z, Huang Y, Huang X, Zhang L, Yao J, Lue N, Lieberman P, Ying H, Paik J, Zheng H
Nature Communications 2023;14(1)
Nature Communications 2023;14(1)
Genetic alterations of the SUMO isopeptidase SENP6 drive lymphomagenesis and genetic instability in diffuse large B-cell lymphoma
Schick M, Zhang L, Maurer S, Maurer H, Isaakaidis K, Schneider L, Patra U, Schunck K, Rohleder E, Hofstetter J, Baluapuri A, Scherger A, Slotta-Huspenina J, Hettler F, Weber J, Engleitner T, Maresch R, Slawska J, Lewis R, Istvanffy R, Habringer S, Steiger K, Baiker A, Oostendorp R, Miething C, Lenhof H, Bassermann F, Chapuy B, Wirth M, Wolf E, Rad R, Müller S, Keller U
Nature Communications 2022;13(1)
Nature Communications 2022;13(1)
SENP6 induces microglial polarization and neuroinflammation through de-SUMOylation of Annexin-A1 after cerebral ischaemia–reperfusion injury
Mao M, Xia Q, Zhan G, Chu Q, Li X, Lian H
Cell & Bioscience 2022;12(1)
Cell & Bioscience 2022;12(1)
Inhibition of SENP6 restrains cerebral ischemia-reperfusion injury by regulating Annexin-A1 nuclear translocation-associated neuronal apoptosis
Xia Q, Mao M, Zeng Z, Luo Z, Zhao Y, Shi J, Li X
Theranostics 2021;11(15):7450-7470
Theranostics 2021;11(15):7450-7470
No comments: Submit comment
No validations: Submit validation data