Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026054-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026054-M01, RRID:AB_489849
- Product name
- SENP6 monoclonal antibody (M01), clone 4B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SENP6.
- Antigen sequence
MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWS
FDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKL
NRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNP
IGLNM- Isotype
- IgG
- Antibody clone number
- 4B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Negative regulation of TLR inflammatory signaling by the SUMO-deconjugating enzyme SENP6.
Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex.
SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress.
Liu X, Chen W, Wang Q, Li L, Wang C
PLoS pathogens 2013;9(6):e1003480
PLoS pathogens 2013;9(6):e1003480
Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex.
Dou H, Huang C, Singh M, Carpenter PB, Yeh ET
Molecular cell 2010 Aug 13;39(3):333-45
Molecular cell 2010 Aug 13;39(3):333-45
SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress.
Han Y, Huang C, Sun X, Xiang B, Wang M, Yeh ET, Chen Y, Li H, Shi G, Cang H, Sun Y, Wang J, Wang W, Gao F, Yi J
The Journal of biological chemistry 2010 Apr 23;285(17):12906-15
The Journal of biological chemistry 2010 Apr 23;285(17):12906-15
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SENP6 monoclonal antibody (M01), clone 4B7 Western Blot analysis of SENP6 expression in IMR-32 ( Cat # L008V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SENP6 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SENP6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol