HPA024376

SENP6 antibody from Sigma-Aldrich
KIAA0797, SUSP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024376
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024376, RRID:AB_1856678
Product name
Anti-SENP6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024376
Antibody type
Polyclonal
Antigen
Sentrin-specific protease 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGP
LLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPI
DIIVNCDDSKHTYLQTNGKVILPGAKIPKITNLKE
RKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQP
ADSACSSPA
Storage
-20C
Provider Type Product Number
- No reagents -