Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487175 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Prostaglandin-Endoperoxide Synthase 1 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PTGS1 antibody: synthetic peptide directed towards the middle region of human PTGS1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLK
YQVLD GEMYPPSVEE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic polymorphisms in mediators of inflammation and gastric precancerous lesions.
Canzian F, Franceschi S, Plummer M, van Doorn LJ, Lu Y, Gioia-Patricola L, Vivas J, Lopez G, Severson RK, Schwartz AG, Muñoz N, Kato I
European journal of cancer prevention : the official journal of the European Cancer Prevention Organisation (ECP) 2008 Apr;17(2):178-83
European journal of cancer prevention : the official journal of the European Cancer Prevention Organisation (ECP) 2008 Apr;17(2):178-83
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry