HPA002834

PTGS1 antibody from Atlas Antibodies
COX1, PGHS-1, PTGHS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002834
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002834, RRID:AB_1079711
Product name
Anti-PTGS1
Provider product page
Atlas Antibodies - HPA002834
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDA
FSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRL
QPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELY
GDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFS
LKGLLGN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -