HPA002834

PTGS1 antibody from Sigma-Aldrich
COX1, PGHS-1, PTGHS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002834
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002834, RRID:AB_1079711
Product name
Anti-PTGS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002834
Antibody type
Polyclonal
Antigen
Prostaglandin G/H synthase 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDA
FSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRL
QPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELY
GDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFS
LKGLLGN
Storage
-20C
Provider Type Product Number
- No reagents -