H00055850-B01

USE1 antibody from Abnova Corporation
D12, MDS032, p31, SLT1

Antibody data

Product number
H00055850-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055850-B01, RRID:AB_1138596
Product name
MDS032 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055850-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MDS032 protein.
Antigen sequence
MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKY
VGALEDMLQALKVHASKPASEVINEYSWKVDFLKG
MLQAEKLTSSSEKALANQFLAPGRVPTTARERVPA
TKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKR
TGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEE
MLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQ
NLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIF
ISMILFIRIMPKLK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -